Web Analysis for Adanaevdenevenakliyatfirmalari - adanaevdenevenakliyatfirmalari.com
Adana evden eve nakliyat ve Adana evden eve taşımacılık firması olarak siz değerli müşterilerimize hizmet vermekten gurur duyarız. Sayısız referanslarımıza site üzerinden ulaşa bilirsiniz, dilerseniz iletişim bölümünden iletişime geçebilirsiniz.
adanaevdenevenakliyatfirmalari.com is 9 years 10 months old. It is a domain having com extension. It has a global traffic rank of #6395157 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, adanaevdenevenakliyatfirmalari.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | 132 |
Daily Pageviews: | 264 |
Estimated Valuation
Income Per Day: | $ 1.00 |
Estimated Worth: | $ 240.00 |
Search Engine Indexes
Google Indexed Pages: | 139 |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 14,600,000 |
Bing Backlinks: | 88 |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | 6,395,157 |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 4 | H2 Headings: | 3 |
H3 Headings: | 1 | H4 Headings: | Not Applicable |
H5 Headings: | 9 | H6 Headings: | 7 |
Total IFRAMEs: | Not Applicable | Total Images: | 14 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 176.53.35.62)
Güzel Sözler, Güzel Mesajlar... Guzelsozler.com.tr
Güzel sözler hayatın dinamizmini arttırır, insanlara motivasyon sağlar, başarının anahtarı hakkında yol gösterir. Guzelsozler.com.tr Adresinde En Güzel Sözler, En Güzel Mesajlar,Özlü Sözler, Anlamlı Sözler, Kitap Alıntılarından ve Şarkı Sözlerinden Hayata Dair Binlerce Söz Bulabilir, Sosyal Medya Platformlarında Twitte
Chat Sohbet Odaları Çet Sohbet Chat Odaları
Çet Sohbet sitesi siz kullanıcılara chat ve sohbet etme imkanı sunan, eğlenceli sohbet odaları ile seviyeli chat odaları bulunan arkadaşlık sitesidir.
Yayın Akışı - Tv Rehberi - Tvde Bugün Ne Var
Yayın Akışı : Kanalların yayın akışlarını sitemizde bulabilirsiniz.
Elektronik Devreler - Elektronik Devre Elemanları - Robotik ve Kodlama
Kondansatör direnç transistör opamp osiloskop led lamba Akım amper volt ohm kanunu nedir renk kodları Robot arduino dc motor nedir
İzmir Kemeraltı Çarşısı - Kemeraltı
restoran kadın abiye elbise gelinlik modelleri alışveriş hamile giyim gece elbiseleri erkek takım gömlek
HTTP Header Analysis
Last-Modified: Thu, 14 Mar 2019 06:42:31 GMT
Content-Type: text/html
Content-Length: 5646
Accept-Ranges: bytes
Content-Encoding: gzip
Vary: Accept-Encoding,User-Agent
Date: Sun, 15 Dec 2019 15:19:25 GMT
Server: LiteSpeed
Alt-Svc: quic=":443"; ma=2592000; v="35,39,43,44"
Connection: Keep-Alive
Domain Information
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
adanaevdenevenakliyatfirmalari.com | A | 10799 |
IP: 176.53.35.62 |
adanaevdenevenakliyatfirmalari.com | NS | 86400 |
Target: ns11.guzelhosting.com |
adanaevdenevenakliyatfirmalari.com | NS | 86400 |
Target: ns12.guzelhosting.com |
adanaevdenevenakliyatfirmalari.com | NS | 86400 |
Target: ns1.guzelhosting.com |
adanaevdenevenakliyatfirmalari.com | NS | 86400 |
Target: ns2.guzelhosting.com |
adanaevdenevenakliyatfirmalari.com | SOA | 10800 |
MNAME: ns1.guzelhosting.com RNAME: monitor.guzel.net.tr Serial: 2019020400 Refresh: 3600 Retry: 10800 Expire: 1209600 Minimum TTL: 86400 |
adanaevdenevenakliyatfirmalari.com | MX | 14400 |
Target: adanaevdenevenakliyatfirmalari.com |
Similarly Ranked Websites
Gereja Gembala Yang Baik | Surabaya
Website resmi Gereja Gembala Yang Baik (GYB). Tersedia jadwal misa dan berbagai hal lainnya. GYB berlokasi di Surabaya, Indonesia
Akynzeo® | Prevent Chemotherapy-induced Nausea and Vomiting
AKYNZEO® is an antiemetic prescription medicine used to help prevent the nausea and vomiting caused by some chemotherapy treatments. Talk to your doctor.
PureTaboo.com - We push the boundaries!
OFFICIAL HOME OF PURETABOO! Watch as horny MILFs and used up wives are degraded, naughty step daughters choke on daddy’s cock, family taboo, manipulation and humiliation porn, where even the sweetest teens will be made into sluts! Join today and witness hardcore porn like you’ve never seen it before!
Full WHOIS Lookup
Registry Domain ID: 1865614199_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2018-08-23T10:57:44Z
Creation Date: 2014-07-05T15:45:48Z
Registrar Registration Expiration Date: 2021-07-05T15:45:48Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Ersin Erdogan
Registrant Organization: adanatransevdeneve@gmail.com
Registrant Street: Tellidere mah 72117 sok no 8
Registrant City: Adana
Registrant State/Province: Seyhan
Registrant Postal Code: 01160
Registrant Country: TR
Registrant Phone: +32.222245555
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: adanatransevdeneve@gmail.com
Registry Admin ID: Not Available From Registry
Admin Name: Ersin Erdogan
Admin Organization: adanatransevdeneve@gmail.com
Admin Street: Tellidere mah 72117 sok no 8
Admin City: Adana
Admin State/Province: Seyhan
Admin Postal Code: 01160
Admin Country: TR
Admin Phone: +32.222245555
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: adanatransevdeneve@gmail.com
Registry Tech ID: Not Available From Registry
Tech Name: Ersin Erdogan
Tech Organization: adanatransevdeneve@gmail.com
Tech Street: Tellidere mah 72117 sok no 8
Tech City: Adana
Tech State/Province: Seyhan
Tech Postal Code: 01160
Tech Country: TR
Tech Phone: +32.222245555
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: adanatransevdeneve@gmail.com
Name Server: ns11.guzelhosting.com
Name Server: ns12.guzelhosting.com
Name Server: ns1.guzelhosting.com
Name Server: ns2.guzelhosting.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-15T15:19:44Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
Registration Service Provided By: GNET INTERNET TELEKOMUNIKASYON A.S.
The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is PDR Ltd. d/b/a PublicDomainRegistry.com.
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.